Catalogo Articoli (Spogli Riviste)

OPAC HELP

Titolo:
Inhibition of human platelet aggregation by L-amino acid oxidase purified from Naja naja kaouthia venom
Autore:
Sakurai, Y; Takatsuka, H; Yoshioka, A; Matsui, T; Suzuki, M; Titani, K; Fujimura, Y;
Indirizzi:
Nara Med Univ, Dept Blood Transfus Med, Nara 6348522, Japan Nara Med UnivNara Japan 6348522 Blood Transfus Med, Nara 6348522, Japan Nara Med Univ, Dept Pediat, Nara 6348522, Japan Nara Med Univ Nara Japan6348522 Univ, Dept Pediat, Nara 6348522, Japan Fujita Hlth Univ, Inst Comprehens Med Sci, Aichi 4701192, Japan Fujita Hlth Univ Aichi Japan 4701192 ehens Med Sci, Aichi 4701192, Japan
Titolo Testata:
TOXICON
fascicolo: 12, volume: 39, anno: 2001,
pagine: 1827 - 1833
SICI:
0041-0101(200112)39:12<1827:IOHPAB>2.0.ZU;2-R
Fonte:
ISI
Lingua:
ENG
Soggetto:
OPHIOPHAGUS-HANNAH VENOM; VONWILLEBRAND-FACTOR; HYDROGEN-PEROXIDE; SNAKE-VENOM; PURIFICATION; PROTEIN; FIG1;
Keywords:
platelet aggregation; L-amino acid oxidase; snake venom; Naja naja kaouthia;
Tipo documento:
Article
Natura:
Periodico
Settore Disciplinare:
Life Sciences
Citazioni:
24
Recensione:
Indirizzi per estratti:
Indirizzo: Fujimura, Y Nara Med Univ, Dept Blood Transfus Med, 840 Shijo Cho, Nara 6348522, Japan Nara Med Univ 840 Shijo Cho Nara Japan 6348522 6348522, Japan
Citazione:
Y. Sakurai et al., "Inhibition of human platelet aggregation by L-amino acid oxidase purified from Naja naja kaouthia venom", TOXICON, 39(12), 2001, pp. 1827-1833

Abstract

L-Amino acid oxidase (LAO) widely exists in snake venoms. Purification of LAO from the Naja naja kaouthia (monocellate cobra) venom has been reported(Tan and Swaminathan, 1992), but its structural characterization and physiological function remained to be determined. The function of snake venom LAOs in hemostasis, especially their effect on platelet aggregation, has beencontroversial. We determined the N-terminal amino acid sequence of the N. n. kaouthia LAO named K-LAO to be DDRRSPLEECFQQNDYEEFLEIAKNGLKKTxNPKHVXxV (38 residues). The protein data base search revealed that the enzyme had high similarities with other snake venom LAOs. Further, platelet aggregation studies revealed that K-LAO functionally did not induce platelet aggregationin a platelet-rich plasma system, but that it inhibited platelet aggregation induced by agonists such as ADP, collagen and ristocetin in a dose-dependent manner. K-LAO diminished platelet aggregation more intensely under lowthan high shear stress. This inhibitory activity of K-LAO on either ristocetin-induced or shear-induced platelet aggregation was quenched by additionof catalase. These results indicate that K-LAO functions as an inhibitor to platelet aggregation through the formation of hydrogen peroxide. The enzyme may contribute to the development of a severe hematological disorder dueto cobra envenomation. (C) 2001 Elsevier Science Ltd. All rights reserved.

ASDD Area Sistemi Dipartimentali e Documentali, Università di Bologna, Catalogo delle riviste ed altri periodici
Documento generato il 28/03/20 alle ore 13:02:35