Catalogo Articoli (Spogli Riviste)

OPAC HELP

Titolo:
PURIFICATION AND GENERAL-PROPERTIES OF AN OLIGOPEPTIDASE FROM TREPONEMA-DENTICOLA ATCC-35405 - A HUMAN ORAL SPIROCHETE
Autore:
MAKINEN KK; MAKINEN PL; LOESCHE WJ; SYED SA;
Indirizzi:
UNIV MICHIGAN,SCH DENT,DEPT BIOL & MAT SCI ANN ARBOR MI 48109
Titolo Testata:
Archives of biochemistry and biophysics
fascicolo: 2, volume: 316, anno: 1995,
pagine: 689 - 698
SICI:
0003-9861(1995)316:2<689:PAGOAO>2.0.ZU;2-X
Fonte:
ISI
Lingua:
ENG
Soggetto:
TRYPSIN-LIKE ACTIVITY; ANAEROBIC PERIODONTAL INFECTIONS; DL-ARGININE-NAPHTHYLAMIDE; PORPHYROMONAS-GINGIVALIS; SUBSTRATE-SPECIFICITY; BENZOYLARGININE PEPTIDASE; PROLYL OLIGOPEPTIDASE; SUBGINGIVAL PLAQUE; BANA TEST; DISEASE;
Keywords:
ENDO-ACTING PEPTIDASE; ARGINYL OLIGOPEPTIDASE; SPIROCHETES; ENZYME PURIFICATION; TRYPSIN-LIKE ENZYMES;
Tipo documento:
Article
Natura:
Periodico
Settore Disciplinare:
Science Citation Index Expanded
Science Citation Index Expanded
Citazioni:
52
Recensione:
Indirizzi per estratti:
Citazione:
K.K. Makinen et al., "PURIFICATION AND GENERAL-PROPERTIES OF AN OLIGOPEPTIDASE FROM TREPONEMA-DENTICOLA ATCC-35405 - A HUMAN ORAL SPIROCHETE", Archives of biochemistry and biophysics, 316(2), 1995, pp. 689-698

Abstract

An endo-acting oligopeptidase (OPase) was purified to homogeneity from the cells of Treponema denticola ATCC 35405-a human oral spirochete-by a procedure that comprised a mild Triton X-100 extraction (which disintegrates the outer membrane but leaves the cells morphologically intact) and four successive fast protein liquid chromatographic steps ofthe extract. The activity of this oligopeptidase (formerly named ''trypsin-like'' enzyme and ''BANA-peptidase'') together with the proteinase activities of T. denticola and Porphyromonas gingivalis is utilizedin a diagnostic test for human periodontal infections, but the enzyme's chemical nature has not been studied. The enzyme is a cell-associated 78-kDa protein with an isoelectric point of 6.1, and its estimated minimum peptide length was 688 amino acid residues. The OPase does nothydrolyze proteins, but hydrolyzes -X-Arg-p-nitroaniline peptides between arginine and the chromogen, the optimum pH of hydrolysis coveringa broad pH range (7 to 9). The OPase is not a metalloenzyme, although1.0 mmol/liter Ca(II) increases the rate of the hydrolysis of all substrates. Ca(II) did not affect the values of the Michaelis constant. The OPase activity is not dependent on reactive SH-groups, but is suggested to depend on he catalytic triad COOH...His...Ser. The N-terminal sequence for the first 29 amino acid residues is MKQSDFEKPPIAEIKETRFEKFGKTRIDN. The purified enzyme is very sensitive to chlorhexidine acetate (mixed inhibition; K-i = 0.85 mu M) and somewhat less sensitive to bacitracin (K-i(app) = 27.5 mu M). The present OPase is considered to belong to the serine peptidases, functionally resembling trypsin except that the OPase does not hydrolyze proteins. The OPase may be regarded as an oligopeptidase, the substrate specificity profile of which resembles to a certain extent that of some members of the coagulation cascade. (C) 1995 Academic Press, Inc.

ASDD Area Sistemi Dipartimentali e Documentali, Università di Bologna, Catalogo delle riviste ed altri periodici
Documento generato il 28/11/20 alle ore 21:17:18